PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.010G247200.1
Common NameB456_010G247200, LOC105773816
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 299aa    MW: 32972.2 Da    PI: 5.882
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.010G247200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.92.3e-333791155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        kprlrWt +LH+rFv+av+qLGG++kAtPk+i+++m+vkgLtl h+kSHLQkYRl
  Gorai.010G247200.1 37 KPRLRWTADLHDRFVDAVTQLGGPNKATPKAIMRTMNVKGLTLFHLKSHLQKYRL 91
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-313492IPR009057Homeodomain-like
PROSITE profilePS5129410.2453494IPR017930Myb domain
TIGRFAMsTIGR015571.7E-243792IPR006447Myb domain, plants
SuperFamilySSF466891.04E-163793IPR009057Homeodomain-like
PfamPF002493.0E-73990IPR001005SANT/Myb domain
PfamPF143791.6E-15135180IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MDMYHPSSRL SSQEEMLNNL NRKAIGEPYL VLTSDPKPRL RWTADLHDRF VDAVTQLGGP  60
NKATPKAIMR TMNVKGLTLF HLKSHLQKYR LGKQSGKDMG EGPKDGMSAS YLLESPGTNN  120
STINLSTADL NEGYEVREAL RAQMEVQSKL HLQLEAEKHL QIRQDAERKY MAMLERACKM  180
LADHFIGSGA VTETDNLEFG CKMLRNYSVD PLGFYSSQSA EVENACDQEE EMPSGLHSQR  240
GDGSTESCLT SQESPGGLTM EGSPVEGKKK MVNMEATTGS VIWGDTRVNP QGLTGYGM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012451412.10.0PREDICTED: myb family transcription factor APL-like
SwissprotQ9SAK53e-49APL_ARATH; Myb family transcription factor APL
TrEMBLA0A0D2UIM80.0A0A0D2UIM8_G
STRINGGLYMA15G12930.11e-133(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17085911
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.12e-63G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]